PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00004.1.g13590.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 213aa    MW: 22666 Da    PI: 6.7457
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00004.1.g13590.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.11.4e-3651110261
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                     ++++l+cprC stntkfCyynnys++qPr+fC+aCrryWt+GG+lr+vPvGg++r+ k++
  Zjn_sc00004.1.g13590.1.sm.mkhc  51 QQQQLECPRCRSTNTKFCYYNNYSTAQPRHFCRACRRYWTHGGTLRDVPVGGATRRAKRR 110
                                     7899***************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.3E-3253109IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-2555106IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2355109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MAPAASILAA TSAASSKRPA DPVDADHLLA AESSSALTQG DAEAARGKNK QQQQLECPRC  60
RSTNTKFCYY NNYSTAQPRH FCRACRRYWT HGGTLRDVPV GGATRRAKRR RVSDSTELSS  120
SPPQTTTALV SEDTCPPDLS STAFPFLSDG SYLPQFDLGL FGPAALSSWS SVLPDFYEGI  180
APTWDNGTVG AAGVTGAWGD VTGLDFSWPP PGN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107111KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00593DAPTransfer from AT5G66940Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0398412e-68BT039841.1 Zea mays full-length cDNA clone ZM_BFc0046N05 mRNA, complete cds.
GenBankJX4284532e-68JX428453.1 Zea mays subsp. mays clone pUT3047 DOF41 transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448779.13e-75hypothetical protein SORBIDRAFT_06g033010
TrEMBLA0A0A9K5581e-86A0A0A9K558_ARUDO; Uncharacterized protein
STRINGSb06g033010.11e-74(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140472427
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.13e-34Dof family protein